Web Analysis for Tuvalettikanikligiacmafiyatlari - tuvalettikanikligiacmafiyatlari.net
1.67
Rating by CuteStat
tuvalettikanikligiacmafiyatlari.net is 8 years 7 months old. It is a domain having net extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, tuvalettikanikligiacmafiyatlari.net is SAFE to browse.
PageSpeed Score
99
Siteadvisor Rating
Not Applicable
Traffic Report
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
Web Server Information
Hosted IP Address:
77.92.140.32
Hosted Country:
TR
Location Latitude:
41.0214Location Longitude:
28.9948Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | 1 | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 77.92.140.32)
Tam Haber | Güncel Haberler ve Son Dakika Haberleri
Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.
7,102,027
$
240.00
Maya Cupcake | Harika Cupcake Çeşitleri
Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.
19,998,643
$
8.95
Sultangazi Petek Temizliği | Bir başka WordPress sitesi
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Fri, 11 Sep 2015 08:03:10 GMT
Server: Apache/2.4.12 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
Content-Length: 203
Connection: close
Content-Type: text/html;charset=ISO-8859-1
Date: Fri, 11 Sep 2015 08:03:10 GMT
Server: Apache/2.4.12 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
Content-Length: 203
Connection: close
Content-Type: text/html;charset=ISO-8859-1
Domain Information
| Domain Registrar: |
FBS INC.
|
|---|---|
| Registration Date: | Sep 9, 2015, 12:00 AM 8 years 7 months 2 weeks ago |
| Last Modified: | Sep 9, 2015, 12:00 AM 8 years 7 months 2 weeks ago |
| Expiration Date: | Sep 9, 2016, 12:00 AM 7 years 7 months 2 weeks ago |
| Domain Status: |
clientTransferProhibited
|
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.kotuhost.com |
|
212.68.61.245 |
Türkiye
|
| ns2.kotuhost.com |
|
212.68.61.231 |
Türkiye
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| tuvalettikanikligiacmafiyatlari.net | A | 14399 |
IP: 77.92.140.32 |
| tuvalettikanikligiacmafiyatlari.net | NS | 21599 |
Target: ns2.kotuhost.com |
| tuvalettikanikligiacmafiyatlari.net | NS | 21599 |
Target: ns1.kotuhost.com |
| tuvalettikanikligiacmafiyatlari.net | SOA | 21599 |
MNAME: ns1.kotuhost.com RNAME: destek.labina.com.tr Serial: 2015090903 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 86400 |
| tuvalettikanikligiacmafiyatlari.net | MX | 14399 |
Target: tuvalettikanikligiacmafiyatlari.net |
| tuvalettikanikligiacmafiyatlari.net | TXT | 14399 |
TXT: v=spf1 +a +mx +ip4:77.92.140.32 ~all |
Full WHOIS Lookup
Domain Name: TUVALETTIKANIKLIGIACMAFIYATLARI.NET
Registry Domain ID: 1958643211_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2015-09-09T10:56:19Z
Creation Date: 2015-09-09T10:56:20Z
Registrar Registration Expiration Date: 2016-09-09T10:56:20Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Admin Domain Admin
Registrant Organization: whoisprotection biz
Registrant Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Registrant City: Istanbul
Registrant State/Province:
Registrant Postal Code: 34000
Registrant Country: TR
Registrant Phone: +90.2163299393
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@whoisprotection.biz
Registry Admin ID:
Admin Name: Domain Admin Domain Admin
Admin Organization: whoisprotection biz
Admin Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Admin City: Istanbul
Admin State/Province:
Admin Postal Code: 34000
Admin Country: TR
Admin Phone: +90.2163299393
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@whoisprotection.biz
Registry Tech ID:
Tech Name: Domain Admin Domain Admin
Tech Organization: whoisprotection biz
Tech Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Tech City: Istanbul
Tech State/Province:
Tech Postal Code: 34000
Tech Country: TR
Tech Phone: +90.2163299393
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@whoisprotection.biz
Name Server: ns1.kotuhost.com
Name Server: ns2.kotuhost.com
DNSSEC:Unsigned
Registrar Abuse Contact Email: abuse@domaintime.biz
Registrar Abuse Contact Phone: +90.8502000444
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>>Last update of WHOIS database: 2015-09-11T08:03:10+0000Z
Registry Domain ID: 1958643211_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2015-09-09T10:56:19Z
Creation Date: 2015-09-09T10:56:20Z
Registrar Registration Expiration Date: 2016-09-09T10:56:20Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Admin Domain Admin
Registrant Organization: whoisprotection biz
Registrant Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Registrant City: Istanbul
Registrant State/Province:
Registrant Postal Code: 34000
Registrant Country: TR
Registrant Phone: +90.2163299393
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: contact@whoisprotection.biz
Registry Admin ID:
Admin Name: Domain Admin Domain Admin
Admin Organization: whoisprotection biz
Admin Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Admin City: Istanbul
Admin State/Province:
Admin Postal Code: 34000
Admin Country: TR
Admin Phone: +90.2163299393
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: contact@whoisprotection.biz
Registry Tech ID:
Tech Name: Domain Admin Domain Admin
Tech Organization: whoisprotection biz
Tech Street: Bulgurlu Uskudar Note Visit whoisprotection biz t
Tech City: Istanbul
Tech State/Province:
Tech Postal Code: 34000
Tech Country: TR
Tech Phone: +90.2163299393
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: contact@whoisprotection.biz
Name Server: ns1.kotuhost.com
Name Server: ns2.kotuhost.com
DNSSEC:Unsigned
Registrar Abuse Contact Email: abuse@domaintime.biz
Registrar Abuse Contact Phone: +90.8502000444
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>>Last update of WHOIS database: 2015-09-11T08:03:10+0000Z
